PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016625.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 270aa    MW: 30434.1 Da    PI: 4.971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016625.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.18.3e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd +l++ +   G  +W+++++  g+ R++k+c++rw +yl
      Pbr016625.1 14 KGPWIAEEDTKLINFILANGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.26e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d++++lG++ W++Ia++++ gRt++++k++w+++
      Pbr016625.1  71 SEYEEKMVIDLHAELGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-19563IPR009057Homeodomain-like
PROSITE profilePS5129411.505961IPR017930Myb domain
SuperFamilySSF466893.91E-2511108IPR009057Homeodomain-like
SMARTSM007174.2E-91363IPR001005SANT/Myb domain
PfamPF002491.3E-111461IPR001005SANT/Myb domain
CDDcd001675.30E-61661No hitNo description
PROSITE profilePS5129425.6862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2464116IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002493.2E-1471111IPR001005SANT/Myb domain
CDDcd001671.60E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRKPCCDKV GLKKGPWIAE EDTKLINFIL ANGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAELGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHKPIA NVNDQSQQSQ RQKQEGEEEQ SCAANDKFEI DQNAPTQAKE EDSKNMGGDG  180
LDKMEFLIDG FCIDEVPLME FLIDGVPSSS SNSSSSSSNS SSNFLEELHL PDFEWPDCDY  240
SNNSNNGSMG LWDDDFSSWG QESWAYGLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370048.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-83ODO1_PETHY; Protein ODORANT1
TrEMBLM5XD571e-137M5XD57_PRUPE; Uncharacterized protein
STRINGPOPTR_0004s08480.11e-109(Populus trichocarpa)
STRINGPOPTR_0017s02850.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-90myb domain protein 20